Lineage for d3jula1 (3jul A:2-308)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137812Species Listeria innocua [TaxId:1642] [196383] (4 PDB entries)
  8. 2137816Domain d3jula1: 3jul A:2-308 [196528]
    Other proteins in same PDB: d3jula2
    automated match to d2jg5a_
    complexed with mg, ta6

Details for d3jula1

PDB Entry: 3jul (more details), 2.4 Å

PDB Description: Crystal structure of Listeria innocua D-Tagatose-6-Phosphate Kinase bound with substrate
PDB Compounds: (A:) Lin2199 protein

SCOPe Domain Sequences for d3jula1:

Sequence, based on SEQRES records: (download)

>d3jula1 c.72.1.0 (A:2-308) automated matches {Listeria innocua [TaxId: 1642]}
iytitlnpaidrllfirgelekrktnrviktefdcggkglhvsgvlskfgiknealgiag
sdnldklyailkekhinhdflveagtstrecfvvlsddtngstmipeagftvsqtnkdnl
lkqiakkvkkedmvviagsppphytlsdfkellrtvkatgaflgcdnsgeylnlavemgv
dfikpnedeviaildektnsleenirtlaekipylvvslgakgsicahngklyqvippkv
qerndtgagdvfvgafiaglamnmpitetlkvatgcsaskvmqqdsssfdleaagklknq
vsiiqle

Sequence, based on observed residues (ATOM records): (download)

>d3jula1 c.72.1.0 (A:2-308) automated matches {Listeria innocua [TaxId: 1642]}
iytitlnpaidrllfirgelekrktnrviktefdcggkglhvsgvlskfgiknealgiag
sdnldklyailkekhinhdflveagtstrecfvvlsddtngstmipeagftvsqtnkdnl
lkqiakkvkkedmvviagsppphytlsdfkellrtvkatgaflgcdnsgeylnlavemgv
dfikpnedeviaildektnsleenirtlaekipylvvslgakgsicahngklyqvipptg
agdvfvgafiaglamnmpitetlkvatgcsaskvmqqfdleaagklknqvsiiqle

SCOPe Domain Coordinates for d3jula1:

Click to download the PDB-style file with coordinates for d3jula1.
(The format of our PDB-style files is described here.)

Timeline for d3jula1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jula2