Lineage for d3jvma1 (3jvm A:349-460)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708299Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries)
  8. 2708301Domain d3jvma1: 3jvm A:349-460 [196527]
    Other proteins in same PDB: d3jvma2
    automated match to d1x0ja_
    complexed with bme, edo

Details for d3jvma1

PDB Entry: 3jvm (more details), 1.2 Å

PDB Description: Crystal structure of bromodomain 2 of mouse Brd4
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d3jvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jvma1 a.29.2.0 (A:349-460) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
skiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskl
esreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd

SCOPe Domain Coordinates for d3jvma1:

Click to download the PDB-style file with coordinates for d3jvma1.
(The format of our PDB-style files is described here.)

Timeline for d3jvma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jvma2