SCOPe 2.08: Domain d3a3tf1: 3a3t F:24-212

Lineage for d3a3tf1 (3a3t F:24-212)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [196523] (3 PDB entries)

8. Domain d3a3tf1: 3a3t F:24-212 [196524]
   Other proteins in same PDB: d3a3ta2, d3a3tb2, d3a3tc2, d3a3td2, d3a3te2, d3a3tf2
   automated match to d3h93a_

Details for d3a3tf1

PDB Entry: 3a3t, 2.1 Å

PDB Description: The oxidoreductase NmDsbA1 from N. meningitidis

PDB Compounds: (F:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3a3tf1:

Sequence; same for both SEQRES and ATOM records:

>d3a3tf1 c.47.1.0 (F:24-212) automated matches {Neisseria meningitidis [TaxId: 491]}
aglvegqnytvlanpipqqqagkvevleffgyfcphcahlepvlskhaksfkddmylrte
hvvwqkemltlarlaaavdmaaadskdvanshifdamvnqkiklqnpevlkkwlgeqtaf
dgkkvlaayespesqaradkmqeltetfqidgtptvivggkykvefadwesgmntidlla
dkvreeqka

Timeline for d3a3tf1:

• d3a3tf1 first appeared in SCOPe 2.02, called d3a3tf_
  
• d3a3tf1 appears in SCOPe 2.07