SCOPe 2.07: Domain d3k2wh1: 3k2w H:5-487

Lineage for d3k2wh1 (3k2w H:5-487)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (59 species)
   not a true protein

7. Species Pseudoalteromonas atlantica [TaxId:342610] [196520] (1 PDB entry)

8. Domain d3k2wh1: 3k2w H:5-487 [196521]
   Other proteins in same PDB: d3k2wa2, d3k2wb2, d3k2wb3, d3k2wc2, d3k2we2, d3k2wg2, d3k2wh2
   automated match to d2opxa_
   complexed with act, cl, gol

Details for d3k2wh1

PDB Entry: 3k2w, 1.9 Å

PDB Description: crystal structure of betaine-aldehyde dehydrogenase from pseudoalteromonas atlantica t6c

PDB Compounds: (H:) Betaine-aldehyde dehydrogenase

SCOPe Domain Sequences for d3k2wh1:

Sequence; same for both SEQRES and ATOM records:

>d3k2wh1 c.82.1.0 (H:5-487) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]}
dlhfknkvnfiggqyvpsnesdtidilspstgkvigeipagckadaenalevaqaaqkaw
akltartrqnmlrtfankirenkhilapmlvaeqgkllsvaemevdvtatfidygcdnal
tiegdilpsdnqdekiyihkvprgvvvgitawnfplalagrkigpalitgntmvlkptqe
tplattelgriakeaglpdgvlnvingtgsvvgqtlcespitkmitmtgstvagkqiykt
saeymtpvmlelggkapmvvmddadldkaaedalwgrfancgqvctcverlyvhasvyde
fmakflplvkglkvgdpmdadsqmgpkcnqreidnidhivheaikqgatvatggktatve
gfeggcwyeptvlvdvkqdnivvheetfgpilpivkvssmeqaiefcndsiyglsayvht
qsfaninqaisdlevgevyinrgmgeqhqgfhngwkqsgfggedgkfgleqylekktvyi
nea

Timeline for d3k2wh1:

• d3k2wh1 first appeared in SCOPe 2.02, called d3k2wh_
  
• d3k2wh1 appears in SCOPe 2.06
  
• d3k2wh1 appears in the current release, SCOPe 2.08