Lineage for d3k2wh1 (3k2w H:5-487)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141435Species Pseudoalteromonas atlantica [TaxId:342610] [196520] (1 PDB entry)
  8. 2141443Domain d3k2wh1: 3k2w H:5-487 [196521]
    Other proteins in same PDB: d3k2wa2, d3k2wb2, d3k2wb3, d3k2wc2, d3k2we2, d3k2wg2, d3k2wh2
    automated match to d2opxa_
    complexed with act, cl, gol

Details for d3k2wh1

PDB Entry: 3k2w (more details), 1.9 Å

PDB Description: crystal structure of betaine-aldehyde dehydrogenase from pseudoalteromonas atlantica t6c
PDB Compounds: (H:) Betaine-aldehyde dehydrogenase

SCOPe Domain Sequences for d3k2wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k2wh1 c.82.1.0 (H:5-487) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]}
dlhfknkvnfiggqyvpsnesdtidilspstgkvigeipagckadaenalevaqaaqkaw
akltartrqnmlrtfankirenkhilapmlvaeqgkllsvaemevdvtatfidygcdnal
tiegdilpsdnqdekiyihkvprgvvvgitawnfplalagrkigpalitgntmvlkptqe
tplattelgriakeaglpdgvlnvingtgsvvgqtlcespitkmitmtgstvagkqiykt
saeymtpvmlelggkapmvvmddadldkaaedalwgrfancgqvctcverlyvhasvyde
fmakflplvkglkvgdpmdadsqmgpkcnqreidnidhivheaikqgatvatggktatve
gfeggcwyeptvlvdvkqdnivvheetfgpilpivkvssmeqaiefcndsiyglsayvht
qsfaninqaisdlevgevyinrgmgeqhqgfhngwkqsgfggedgkfgleqylekktvyi
nea

SCOPe Domain Coordinates for d3k2wh1:

Click to download the PDB-style file with coordinates for d3k2wh1.
(The format of our PDB-style files is described here.)

Timeline for d3k2wh1: