SCOPe 2.05: Domain d2ctha_: 2cth A:

Lineage for d2ctha_ (2cth A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio vulgaris [TaxId:881] [48699] (18 PDB entries)
   Uniprot P00132

8. Domain d2ctha_: 2cth A: [19652]
   complexed with hem

Details for d2ctha_

PDB Entry: 2cth, 1.67 Å

PDB Description: cytochrome c3 from desulfovibrio vulgaris hildenborough

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d2ctha_:

Sequence; same for both SEQRES and ATOM records:

>d2ctha_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche

Timeline for d2ctha_:

• d2ctha_ first appeared (with stable ids) in SCOP 1.55
  
• d2ctha_ appears in SCOPe 2.04
  
• d2ctha_ appears in SCOPe 2.06
  
• d2ctha_ appears in the current release, SCOPe 2.08