Lineage for d3iw4c_ (3iw4 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (733 PDB entries)
  8. 2546052Domain d3iw4c_: 3iw4 C: [196517]
    automated match to d2i0ea_
    complexed with lw4

Details for d3iw4c_

PDB Entry: 3iw4 (more details), 2.8 Å

PDB Description: crystal structure of pkc alpha in complex with nvp-aeb071
PDB Compounds: (C:) Protein kinase C alpha type

SCOPe Domain Sequences for d3iw4c_:

Sequence, based on SEQRES records: (download)

>d3iw4c_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqdddvectmvekr
vlalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkepqavfyaaeisi
glfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttrefcgtpdyiapei
iayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsypkslskeavsic
kglmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkvcgkgaenfdkf
ftrgqpvltppdqlvianidqsdfegfsyvnpqfvhpilqs

Sequence, based on observed residues (ATOM records): (download)

>d3iw4c_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqdddvectmvekr
vlalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkepqavfyaaeisi
glfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttrefcgtpdyiapei
iayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsypkslskeavsic
kglmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkvfdkfftrgqpv
ltppdqlvianidqsdfegfsyvnpqfvhpilqs

SCOPe Domain Coordinates for d3iw4c_:

Click to download the PDB-style file with coordinates for d3iw4c_.
(The format of our PDB-style files is described here.)

Timeline for d3iw4c_: