Lineage for d3he8b_ (3he8 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2921987Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 2922028Protein automated matches [191284] (1 species)
    not a true protein
  7. 2922029Species Clostridium thermocellum [TaxId:203119] [189908] (4 PDB entries)
  8. 2922031Domain d3he8b_: 3he8 B: [196513]
    automated match to d3ph4a_
    complexed with gol

Details for d3he8b_

PDB Entry: 3he8 (more details), 1.9 Å

PDB Description: Structural study of Clostridium thermocellum Ribose-5-Phosphate Isomerase B
PDB Compounds: (B:) Ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3he8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3he8b_ c.121.1.1 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
mkigigsdhggynlkreiadflkkrgyevidfgthgnesvdypdfglkvaeavksgecdr
givicgtglgisiaankvpgiraavctnsymarmsrehndanilalgervvgldlaldiv
dtwlkaefqggrhatrvgkigeiekkys

SCOPe Domain Coordinates for d3he8b_:

Click to download the PDB-style file with coordinates for d3he8b_.
(The format of our PDB-style files is described here.)

Timeline for d3he8b_: