Lineage for d3khma_ (3khm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005985Species Trypanosoma cruzi [TaxId:5693] [196511] (10 PDB entries)
  8. 2005995Domain d3khma_: 3khm A: [196512]
    automated match to d3l4db_
    complexed with hem, tpf

Details for d3khma_

PDB Entry: 3khm (more details), 2.85 Å

PDB Description: Crystal structure of sterol 14alpha-demethylase (CYP51) from Trypanosoma cruzi in complex with inhibitor fluconazole
PDB Compounds: (A:) Sterol 14 alpha-demethylase

SCOPe Domain Sequences for d3khma_:

Sequence, based on SEQRES records: (download)

>d3khma_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ktsgkgklppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdp
hehsrffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfv
paiqhevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllsk
messlipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllg
gllkavyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkei
defpaqlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacs
pllshhdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafrey
dfqllrdevpdpdyhtmvvgptlnqclvkytrkkkl

Sequence, based on observed residues (ATOM records): (download)

>d3khma_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ktsgkgklppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdp
hehsrffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfv
paiqhevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllsk
messlipallrlplpqsarcrearaelqkilgeiivareksdllggllkavyrdgtrmsl
hevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvmde
mpfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpnpr
lwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpdyh
tmvvgptlnqclvkytrkkkl

SCOPe Domain Coordinates for d3khma_:

Click to download the PDB-style file with coordinates for d3khma_.
(The format of our PDB-style files is described here.)

Timeline for d3khma_: