Lineage for d2wzka1 (2wzk A:12-386)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007947Family a.118.17.0: automated matches [196491] (1 protein)
    not a true family
  6. 2007948Protein automated matches [196508] (2 species)
    not a true protein
  7. 2007957Species Mouse (Mus musculus) [TaxId:10090] [196509] (1 PDB entry)
  8. 2007958Domain d2wzka1: 2wzk A:12-386 [196510]
    Other proteins in same PDB: d2wzka2
    automated match to d1ldka_
    complexed with edo

Details for d2wzka1

PDB Entry: 2wzk (more details), 2.05 Å

PDB Description: Structure of the Cul5 N-terminal domain at 2.05A resolution.
PDB Compounds: (A:) Cullin-5

SCOPe Domain Sequences for d2wzka1:

Sequence, based on SEQRES records: (download)

>d2wzka1 a.118.17.0 (A:12-386) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
slqfedkwdfmhpivlkllrqesvtkqqwfdlfsdvhavclwddkgsskihqalkedile
fikqaqarvlshqddtallkayivewrkfftqcdilpkpfcqlevtllgkqssnkksnme
dsivrklmldtwnesifsniknrlqdsamklvhaerlgeafdsqlvigvresyvnlcsnp
edklqiyrdnfekayldsterfyrtqapsylqqngvqnymkyadaklkeeekralrylet
rrecnsvealmeccvnalvtsfketilaecqgmikrneteklhlmfslmdkvpngiepml
kdleehiisagladmvaaaetittdsekyreqldtlfnrfsklvkeafqddprfltardk
aykavvndatifkae

Sequence, based on observed residues (ATOM records): (download)

>d2wzka1 a.118.17.0 (A:12-386) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
slqfedkwdfmhpivlkllrqesvtkqqwfdlfsdvhavclwddkgsskihqalkedile
fikqaqarvlshqddtallkayivewrkfftqcdilpkpfcqlevtllgkmedsivrklm
ldtwnesifsniknrlqdsamklvhaerlgeafdsqlvigvresyvnlcsnpedklqiyr
dnfekayldsterfyrtqapsylqqngvqnymkyadaklkeeekralryletrrecnsve
almeccvnalvtsfketilaecqgmikrneteklhlmfslmdkvpngiepmlkdleehii
sagladmvaaaetittdsekyreqldtlfnrfsklvkeafqddprfltardkaykavvnd
atifkae

SCOPe Domain Coordinates for d2wzka1:

Click to download the PDB-style file with coordinates for d2wzka1.
(The format of our PDB-style files is described here.)

Timeline for d2wzka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wzka2