Lineage for d2cdv__ (2cdv -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6906Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 6907Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 6908Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins)
  6. 6909Protein Cytochrome c3 [48697] (5 species)
  7. 6923Species Desulfovibrio vulgaris [TaxId:881] [48699] (5 PDB entries)
  8. 6926Domain d2cdv__: 2cdv - [19651]

Details for d2cdv__

PDB Entry: 2cdv (more details), 1.8 Å

PDB Description: refined structure of cytochrome c3 at 1.8 angstroms resolution

SCOP Domain Sequences for d2cdv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdv__ a.138.1.1 (-) Cytochrome c3 {Desulfovibrio vulgaris}
apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkenyqkcatagchdnmdkkdk
sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

SCOP Domain Coordinates for d2cdv__:

Click to download the PDB-style file with coordinates for d2cdv__.
(The format of our PDB-style files is described here.)

Timeline for d2cdv__: