SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3khfb1 (3khf B:948-1040)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (87 PDB entries)
  8. 2048831Domain d3khfb1: 3khf B:948-1040 [196501]
    Other proteins in same PDB: d3khfa2, d3khfb2
    automated match to d3r68a_
    complexed with cl, edo

Details for d3khfb1

PDB Entry: 3khf (more details), 1.2 Å

PDB Description: The crystal structure of the PDZ domain of human Microtubule Associated Serine/Threonine Kinase 3 (MAST3)
PDB Compounds: (B:) Microtubule-associated serine/threonine-protein kinase 3

SCOPe Domain Sequences for d3khfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3khfb1 b.36.1.0 (B:948-1040) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rppivihssgkkygfslrairvymgdsdvytvhhvvwsvedgspaqeaglragdlithin
gesvlglvhmdvvelllksgnkislrttalent

SCOPe Domain Coordinates for d3khfb1:

Click to download the PDB-style file with coordinates for d3khfb1.
(The format of our PDB-style files is described here.)

Timeline for d3khfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3khfb2