Lineage for d3khfb1 (3khf B:948-1040)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786531Domain d3khfb1: 3khf B:948-1040 [196501]
    Other proteins in same PDB: d3khfa2, d3khfb2
    automated match to d3r68a_
    complexed with cl, edo

Details for d3khfb1

PDB Entry: 3khf (more details), 1.2 Å

PDB Description: the crystal structure of the pdz domain of human microtubule associated serine/threonine kinase 3 (mast3)
PDB Compounds: (B:) Microtubule-associated serine/threonine-protein kinase 3

SCOPe Domain Sequences for d3khfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3khfb1 b.36.1.0 (B:948-1040) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rppivihssgkkygfslrairvymgdsdvytvhhvvwsvedgspaqeaglragdlithin
gesvlglvhmdvvelllksgnkislrttalent

SCOPe Domain Coordinates for d3khfb1:

Click to download the PDB-style file with coordinates for d3khfb1.
(The format of our PDB-style files is described here.)

Timeline for d3khfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3khfb2