Lineage for d3knzf1 (3knz F:2-322)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140515Species Salmonella enterica [TaxId:90371] [196499] (1 PDB entry)
  8. 2140521Domain d3knzf1: 3knz F:2-322 [196500]
    Other proteins in same PDB: d3knza2, d3knzb2, d3knzc2, d3knzd2, d3knze2, d3knzf2
    automated match to d2vf5x1
    complexed with etx, imd

Details for d3knzf1

PDB Entry: 3knz (more details), 2.5 Å

PDB Description: crystal structure of putative sugar binding protein (np_459565.1) from salmonella typhimurium lt2 at 2.50 a resolution
PDB Compounds: (F:) Putative sugar binding protein

SCOPe Domain Sequences for d3knzf1:

Sequence, based on SEQRES records: (download)

>d3knzf1 c.80.1.0 (F:2-322) automated matches {Salmonella enterica [TaxId: 90371]}
netplrllemltqtredlwraaqaltergvtriiltgsgtsyhgaltartfmqrwcalpv
dvcwpfmlddetlarsgkalvvgisqgggslstlaamerarnvghitasmagvapatidr
aadyiltvpcgeetagaktkgyhctvlnlmllalavagqqqrldgeqrrslllrmektfn
hlpalvtasqawaqtnalalrdsadirltgpatlfgtvqegalkmletlrcpvsgyefee
fihgiynafnaqsalimldpqpdarqdrlaqilgewtpsiyrigpqvennglnlnfpfvn
dedfavfeyiiplqmlcailp

Sequence, based on observed residues (ATOM records): (download)

>d3knzf1 c.80.1.0 (F:2-322) automated matches {Salmonella enterica [TaxId: 90371]}
netplrllemltqtredlwraaqaltergvtriiltgsgtsyhgaltartfmqrwcalpv
dvcwpfmlddetlarsgkalvvgisqgggslstlaamerarnvghitasmagvapatidr
aadyiltvptkgyhctvlnlmllalavagqqqrldgeqrrslllrmektfnhlpalvtas
qawaqtnalalrdsadirltgpatlfgtvqegalkmletlrcpvsgyefeefihgiynaf
naqsalimldpqpdarqdrlaqilgewtpsiyrigpqvennglnlnfpfvndedfavfey
iiplqmlcailp

SCOPe Domain Coordinates for d3knzf1:

Click to download the PDB-style file with coordinates for d3knzf1.
(The format of our PDB-style files is described here.)

Timeline for d3knzf1: