SCOPe 2.08: Domain d1aqea_: 1aqe A:

Lineage for d1aqea_ (1aqe A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries)
   Uniprot Q9L915

8. Domain d1aqea_: 1aqe A: [19650]
   complexed with hem, so4; mutant

Details for d1aqea_

PDB Entry: 1aqe, 2.2 Å

PDB Description: crystal structure of the y73e mutant of cytochrome c of class iii (ambler) 26 kd

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1aqea_:

Sequence; same for both SEQRES and ATOM records:

>d1aqea_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
tfeipesvtmspkqfegytpkkgdvtfnhashmdiacqqchhtvpdtytiescmtegchd
nikerteissvertfhttkdsekscvgchrelkrqgpsdaplacnschvq

Timeline for d1aqea_:

• d1aqea_ first appeared (with stable ids) in SCOP 1.55, called d1aqe__
  
• d1aqea_ appears in SCOPe 2.07