| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
| Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
| Protein automated matches [190919] (11 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [196495] (2 PDB entries) |
| Domain d3ks6d_: 3ks6 D: [196497] Other proteins in same PDB: d3ks6a2, d3ks6b2 automated match to d2pz0b_ complexed with act, cl, mg, peg, unl |
PDB Entry: 3ks6 (more details), 1.8 Å
SCOPe Domain Sequences for d3ks6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ks6d_ c.1.18.0 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mtriashrggtlefgdstphgftataamaleevefdlhptadgaivvhhdptldattdmt
gaivdmtlakvktatirygagshpmtleelcalyvdshvnfrceikpgvdglpyegfval
viaglerhsmlerttfssfllasmdelwkattrprlwlvspsvlqqlgpgavietaiahs
iheigvhidtadaglmaqvqaagldfgcwaahtpsqitkaldlgvkvfttdrptlaialr
tehrme
Timeline for d3ks6d_: