SCOPe 2.08: Domain d3ks6d_: 3ks6 D:

Lineage for d3ks6d_ (3ks6 D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (11 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [196495] (2 PDB entries)

8. Domain d3ks6d_: 3ks6 D: [196497]
   Other proteins in same PDB: d3ks6a2, d3ks6b2
   automated match to d2pz0b_
   complexed with act, cl, mg, peg, unl

Details for d3ks6d_

PDB Entry: 3ks6, 1.8 Å

PDB Description: crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 1.80 a resolution

PDB Compounds: (D:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d3ks6d_:

Sequence; same for both SEQRES and ATOM records:

>d3ks6d_ c.1.18.0 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mtriashrggtlefgdstphgftataamaleevefdlhptadgaivvhhdptldattdmt
gaivdmtlakvktatirygagshpmtleelcalyvdshvnfrceikpgvdglpyegfval
viaglerhsmlerttfssfllasmdelwkattrprlwlvspsvlqqlgpgavietaiahs
iheigvhidtadaglmaqvqaagldfgcwaahtpsqitkaldlgvkvfttdrptlaialr
tehrme

Timeline for d3ks6d_:

• d3ks6d_ first appeared in SCOPe 2.02
  
• d3ks6d_ appears in SCOPe 2.07