| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
| Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
| Protein automated matches [190919] (11 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [196495] (2 PDB entries) |
| Domain d3ks5b1: 3ks5 B:1-247 [196496] Other proteins in same PDB: d3ks5a2, d3ks5b2 automated match to d2pz0b_ complexed with act, edo, fe |
PDB Entry: 3ks5 (more details), 2.05 Å
SCOPe Domain Sequences for d3ks5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ks5b1 c.1.18.0 (B:1-247) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mtriashrggtlefgdstphgftataamaleevefdlhptadgaivvhhdptldattdmt
gaivdmtlakvktatirygagshpmtleelcalyvdshvnfrceikpgvdglpyegfval
viaglerhsmlerttfssfllasmdelwkattrprlwlvspsvlqqlgpgavietaiahs
iheigvhidtadaglmaqvqaagldfgcwaahtpsqitkaldlgvkvfttdrptlaialr
tehrmea
Timeline for d3ks5b1: