Lineage for d3ksmb1 (3ksm B:40-313)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144137Species Hahella chejuensis [TaxId:349521] [196493] (1 PDB entry)
  8. 2144139Domain d3ksmb1: 3ksm B:40-313 [196494]
    Other proteins in same PDB: d3ksma2, d3ksmb2
    automated match to d2ioya_
    complexed with bdr

Details for d3ksmb1

PDB Entry: 3ksm (more details), 1.9 Å

PDB Description: Crystal structure of ABC-type sugar transport system, periplasmic component from Hahella chejuensis
PDB Compounds: (B:) ABC-type sugar transport system, periplasmic component

SCOPe Domain Sequences for d3ksmb1:

Sequence, based on SEQRES records: (download)

>d3ksmb1 c.93.1.0 (B:40-313) automated matches {Hahella chejuensis [TaxId: 349521]}
klllvlkgdsnaywrqvylgaqkaadeagvtllhrstkddgdiagqiqilsyhlsqappd
alilapnsaedltpsvaqyrarnipvlvvdsdlagdahqglvatdnyaagqlaarallat
ldlskerniallrlragnastdqreqgfldvlrkhdkiriiaapyagddrgaarsemlrl
lketptidglftpnesttigalvairqsgmskqfgfigfdqteeleaamyageisnlvvq
npeymgylavqraldlvrgkpipaftdtgvrllq

Sequence, based on observed residues (ATOM records): (download)

>d3ksmb1 c.93.1.0 (B:40-313) automated matches {Hahella chejuensis [TaxId: 349521]}
klllvlkgdsnaywrqvylgaqkaadeagvtllhrstkddgdiagqiqilsyhlsqapda
lilapnsaedltpsvaqyrarnipvlvvdsdlagdahqglvatdnyaagqlaarallatl
dlskerniallrlragnastdqreqgfldvlrkhdkiriiaapyagddrgaarsemlrll
ketptidglftpnesttigalvairqsgmskqfgfigfdqteeleaamyageisnlvvqn
peymgylavqraldlvrgkpipaftdtgvrllq

SCOPe Domain Coordinates for d3ksmb1:

Click to download the PDB-style file with coordinates for d3ksmb1.
(The format of our PDB-style files is described here.)

Timeline for d3ksmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ksmb2