Lineage for d3l49d1 (3l49 D:29-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913508Species Rhodobacter sphaeroides [TaxId:272943] [196489] (1 PDB entry)
  8. 2913512Domain d3l49d1: 3l49 D:29-309 [196490]
    Other proteins in same PDB: d3l49a2, d3l49b2, d3l49c2, d3l49d2
    automated match to d2ioya_
    complexed with unl

Details for d3l49d1

PDB Entry: 3l49 (more details), 2.3 Å

PDB Description: crystal structure of abc sugar transporter subunit from rhodobacter sphaeroides 2.4.1
PDB Compounds: (D:) ABC sugar (Ribose) transporter, periplasmic substrate-binding subunit

SCOPe Domain Sequences for d3l49d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l49d1 c.93.1.0 (D:29-309) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
legktigitaigtdhdwdlkayqaqiaeierlggtaialdagrndqtqvsqiqtliaqkp
daiieqlgnldvlnpwlqkindagiplftvdtatphainnttsnnysigaelalqmvadl
ggkgnvlvfngfysvpvckirydqmkyvleafpdvkiiepelrdvipntiqsaysnvtdm
ltkypnegdvgaiwacwdvpmigatqalqaagrtdirtygvdgspefvemvadpespaga
vaaqqpseigklavqnvarhlagqevkpftfapavlitken

SCOPe Domain Coordinates for d3l49d1:

Click to download the PDB-style file with coordinates for d3l49d1.
(The format of our PDB-style files is described here.)

Timeline for d3l49d1: