SCOPe 2.08: Domain d2cy3a_: 2cy3 A:

Lineage for d2cy3a_ (2cy3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries)
   Uniprot Q9L915

8. Domain d2cy3a_: 2cy3 A: [19649]
   complexed with hec

Details for d2cy3a_

PDB Entry: 2cy3, 1.7 Å

PDB Description: crystal structure of cytochrome c3 from desulfovibrio desulfuricans norway at 1.7 angstroms resolution

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d2cy3a_:

Sequence; same for both SEQRES and ATOM records:

>d2cy3a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
adapgddyvisapegmkakpkgdkpgalqktvpfphtkhatvecvqchhtleadggavkk
cttsgchdslefrdkanakdiklvenafhtqcidchkalkkdkkptgptacgkchttn

Timeline for d2cy3a_:

• d2cy3a_ first appeared (with stable ids) in SCOP 1.55, called d2cy3__
  
• d2cy3a_ appears in SCOPe 2.07