SCOPe 2.08: Domain d3fwsb_: 3fws B:

Lineage for d3fwsb_ (3fws B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196484] (3 PDB entries)

8. Domain d3fwsb_: 3fws B: [196485]
   automated match to d3kpdb_
   complexed with anp, mg, po4

Details for d3fwsb_

PDB Entry: 3fws, 2.03 Å

PDB Description: Crystal Structure of the CBS domains from the Bacillus subtilis CcpN repressor complexed with AppNp, phosphate and magnesium ions

PDB Compounds: (B:) YqzB protein

SCOPe Domain Sequences for d3fwsb_:

Sequence; same for both SEQRES and ATOM records:

>d3fwsb_ d.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
gktgtqlladklkklqvkdfqsipvvihenvsvydaictmfledvgtlfvvdrdavlvgv
lsrkdllrasigqqeltsvpvhiimtrmpnitvcrredyvmdiakhliekqidalpvikd
tdkgfevigrvtktnmtkilvslsen

Timeline for d3fwsb_:

• d3fwsb_ first appeared in SCOPe 2.02
  
• d3fwsb_ appears in SCOPe 2.07