Lineage for d3ijfx_ (3ijf X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166092Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2166093Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2166372Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2166373Protein automated matches [190746] (12 species)
    not a true protein
  7. 2166419Species Mycobacterium tuberculosis [TaxId:1773] [196473] (3 PDB entries)
  8. 2166420Domain d3ijfx_: 3ijf X: [196474]
    automated match to d3r2nd_
    complexed with zn

Details for d3ijfx_

PDB Entry: 3ijf (more details), 1.99 Å

PDB Description: Crystal structure of cytidine deaminase from Mycobacterium tuberculosis
PDB Compounds: (X:) Cytidine deaminase

SCOPe Domain Sequences for d3ijfx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijfx_ c.97.1.0 (X:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvdwnmlrgnatqaaagayvpysrfavgaaalvddgrvvtgcnvenvsygltlcaecavv
calhstgggrllalacvdghgsvlmpcgrcrqvllehggsellidhpvrprrlgdllpda
fgl

SCOPe Domain Coordinates for d3ijfx_:

Click to download the PDB-style file with coordinates for d3ijfx_.
(The format of our PDB-style files is described here.)

Timeline for d3ijfx_: