Lineage for d1e79i_ (1e79 I:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286285Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)
    not a true fold
  4. 286357Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
  5. 286358Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (1 protein)
  6. 286359Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (1 species)
  7. 286360Species Cow (Bos taurus) [TaxId:9913] [48693] (2 PDB entries)
  8. 286361Domain d1e79i_: 1e79 I: [19647]
    Other proteins in same PDB: d1e79a1, d1e79a2, d1e79a3, d1e79b1, d1e79b2, d1e79b3, d1e79c1, d1e79c2, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2
    complexed with adp, atp, cry, glh, mg, so4

Details for d1e79i_

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79i_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus)}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv

SCOP Domain Coordinates for d1e79i_:

Click to download the PDB-style file with coordinates for d1e79i_.
(The format of our PDB-style files is described here.)

Timeline for d1e79i_: