Lineage for d3lrqd_ (3lrq D:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465026Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1465027Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1465141Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 1465142Protein automated matches [190242] (2 species)
    not a true protein
  7. 1465143Species Human (Homo sapiens) [TaxId:9606] [189860] (2 PDB entries)
  8. 1465149Domain d3lrqd_: 3lrq D: [196465]
    automated match to d2y43b_
    complexed with zn

Details for d3lrqd_

PDB Entry: 3lrq (more details), 2.29 Å

PDB Description: crystal structure of the u-box domain of human ubiquitin-protein ligase (e3), northeast structural genomics consortium target hr4604d.
PDB Compounds: (D:) E3 ubiquitin-protein ligase TRIM37

SCOPe Domain Sequences for d3lrqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lrqd_ g.44.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql
relvncrwaeevtqqldtlqlcsl

SCOPe Domain Coordinates for d3lrqd_:

Click to download the PDB-style file with coordinates for d3lrqd_.
(The format of our PDB-style files is described here.)

Timeline for d3lrqd_: