Lineage for d3m0gb1 (3m0g B:4-287)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010994Species Rhodobacter capsulatus [TaxId:1061] [196462] (2 PDB entries)
  8. 2010996Domain d3m0gb1: 3m0g B:4-287 [196463]
    Other proteins in same PDB: d3m0ga2, d3m0gb2
    automated match to d3p8ra_

Details for d3m0gb1

PDB Entry: 3m0g (more details), 1.9 Å

PDB Description: crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus
PDB Compounds: (B:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d3m0gb1:

Sequence, based on SEQRES records: (download)

>d3m0gb1 a.128.1.0 (B:4-287) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
serlkevqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgismaqa
mpaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafelct
dpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktgali
sfaaqagailagadrgpltayatalglafqiaddildvegneeaagkrlgkdaeahkatf
vsllglagaksraadlvaeaeaalapygeaastlracaryvier

Sequence, based on observed residues (ATOM records): (download)

>d3m0gb1 a.128.1.0 (B:4-287) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
serlkevqdavetamaaaigrlpagdlrdamayaaqggkrlraflaiesaaihgismaqa
mpaalavealhayslvhddmpcmdnddlrrglptvhkkwddatavlagdalqtlafelct
dpvlgsaenrvalvaalaqasgaegmvygqaldiaaetaavpltldeiirlqagktgali
sfaaqagailagadrgpltayatalglafqiaddildvkatfvsllglagaksraadlva
eaeaalapygeaastlracaryvier

SCOPe Domain Coordinates for d3m0gb1:

Click to download the PDB-style file with coordinates for d3m0gb1.
(The format of our PDB-style files is described here.)

Timeline for d3m0gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m0gb2