Lineage for d3abaa_ (3aba A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1499255Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1499256Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1499814Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1499815Protein automated matches [190847] (40 species)
    not a true protein
  7. 1500112Species Streptomyces avermitilis [TaxId:33903] [189294] (5 PDB entries)
  8. 1500113Domain d3abaa_: 3aba A: [196461]
    automated match to d2z36a_
    complexed with fli, hem, so4

Details for d3abaa_

PDB Entry: 3aba (more details), 1.8 Å

PDB Description: Crystal structure of CYP105P1 in complex with filipin I
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d3abaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abaa_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq
vphalhtqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehl
daiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaag
mrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmi
glgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakg
eqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlf
rrlpglrlakpveelrfrhdmvfygvhelpvtwhhhh

SCOPe Domain Coordinates for d3abaa_:

Click to download the PDB-style file with coordinates for d3abaa_.
(The format of our PDB-style files is described here.)

Timeline for d3abaa_: