![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (18 species) not a true protein |
![]() | Species Streptomyces avermitilis [TaxId:33903] [189294] (4 PDB entries) |
![]() | Domain d3abaa_: 3aba A: [196461] automated match to d2z36a_ complexed with fli, hem, so4 |
PDB Entry: 3aba (more details), 1.8 Å
SCOPe Domain Sequences for d3abaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abaa_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]} daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq vphalhtqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehl daiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaag mrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmi glgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakg eqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlf rrlpglrlakpveelrfrhdmvfygvhelpvtwhhhh
Timeline for d3abaa_: