Lineage for d1dp5b_ (1dp5 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733872Superfamily a.137.7: Proteinase A inhibitor IA3 [48686] (1 family) (S)
  5. 2733873Family a.137.7.1: Proteinase A inhibitor IA3 [48687] (1 protein)
  6. 2733874Protein Proteinase A inhibitor IA3 [48688] (1 species)
  7. 2733875Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48689] (3 PDB entries)
  8. 2733878Domain d1dp5b_: 1dp5 B: [19646]
    Other proteins in same PDB: d1dp5a_
    mutant

Details for d1dp5b_

PDB Entry: 1dp5 (more details), 2.2 Å

PDB Description: the structure of proteinase a complexed with a ia3 mutant inhibitor
PDB Compounds: (B:) proteinase inhibitor ia3

SCOPe Domain Sequences for d1dp5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp5b_ a.137.7.1 (B:) Proteinase A inhibitor IA3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntdqqkvseifqsskeklqgdakvvsdafmm

SCOPe Domain Coordinates for d1dp5b_:

Click to download the PDB-style file with coordinates for d1dp5b_.
(The format of our PDB-style files is described here.)

Timeline for d1dp5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dp5a_