Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.7: Proteinase A inhibitor IA3 [48686] (1 family) |
Family a.137.7.1: Proteinase A inhibitor IA3 [48687] (1 protein) |
Protein Proteinase A inhibitor IA3 [48688] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48689] (3 PDB entries) |
Domain d1dp5b_: 1dp5 B: [19646] Other proteins in same PDB: d1dp5a_ mutant |
PDB Entry: 1dp5 (more details), 2.2 Å
SCOPe Domain Sequences for d1dp5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp5b_ a.137.7.1 (B:) Proteinase A inhibitor IA3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ntdqqkvseifqsskeklqgdakvvsdafmm
Timeline for d1dp5b_: