SCOPe 2.07: Domain d3mcfb1: 3mcf B:17-144

Lineage for d3mcfb1 (3mcf B:17-144)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189707] (27 PDB entries)

8. Domain d3mcfb1: 3mcf B:17-144 [196459]
   Other proteins in same PDB: d3mcfa2, d3mcfa3, d3mcfb2
   automated match to d2duka_
   complexed with flc, gol

Details for d3mcfb1

PDB Entry: 3mcf, 2 Å

PDB Description: crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 3-alpha

PDB Compounds: (B:) Diphosphoinositol polyphosphate phosphohydrolase 3-alpha

SCOPe Domain Sequences for d3mcfb1:

Sequence, based on SEQRES records:

>d3mcfb1 d.113.1.1 (B:17-144) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgkl
grllgvfeqnqdpehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvh
aeyleklk

Sequence, based on observed residues (ATOM records):

>d3mcfb1 d.113.1.1 (B:17-144) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgkl
grllgvfehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvhaeylek
lk

Timeline for d3mcfb1:

• d3mcfb1 first appeared in SCOPe 2.02, called d3mcfb_
  
• d3mcfb1 appears in SCOPe 2.06
  
• d3mcfb1 appears in the current release, SCOPe 2.08