Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein automated matches [190465] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189707] (27 PDB entries) |
Domain d3mcfb1: 3mcf B:17-144 [196459] Other proteins in same PDB: d3mcfa2, d3mcfa3, d3mcfb2 automated match to d2duka_ complexed with flc, gol |
PDB Entry: 3mcf (more details), 2 Å
SCOPe Domain Sequences for d3mcfb1:
Sequence, based on SEQRES records: (download)
>d3mcfb1 d.113.1.1 (B:17-144) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgkl grllgvfeqnqdpehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvh aeyleklk
>d3mcfb1 d.113.1.1 (B:17-144) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgkl grllgvfehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvhaeylek lk
Timeline for d3mcfb1: