Lineage for d2wbua_ (2wbu A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243858Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1243859Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1244227Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 1244228Protein automated matches [196455] (1 species)
    not a true protein
  7. 1244229Species Mus musculus [TaxId:10090] [196456] (2 PDB entries)
  8. 1244231Domain d2wbua_: 2wbu A: [196458]
    automated match to d2ee8a1
    protein/DNA complex; complexed with zn

Details for d2wbua_

PDB Entry: 2wbu (more details), 2.5 Å

PDB Description: crystal structure of the zinc finger domain of klf4 bound to its target dna
PDB Compounds: (A:) krueppel-like factor 4

SCOPe Domain Sequences for d2wbua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbua_ g.37.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
thtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsdeltrhyrkhtghr
pfqcqkcdrafsrsdhlalhmkrhf

SCOPe Domain Coordinates for d2wbua_:

Click to download the PDB-style file with coordinates for d2wbua_.
(The format of our PDB-style files is described here.)

Timeline for d2wbua_: