Class g: Small proteins [56992] (90 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.0: automated matches [196454] (1 protein) not a true family |
Protein automated matches [196455] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [196456] (2 PDB entries) |
Domain d2wbsa_: 2wbs A: [196457] automated match to d2ee8a1 protein/DNA complex; complexed with gol, zn |
PDB Entry: 2wbs (more details), 1.7 Å
SCOPe Domain Sequences for d2wbsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbsa_ g.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tathtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsdeltrhyrkhtg hrpfqcqkcdrafsrsdhlalhmkrhf
Timeline for d2wbsa_: