SCOPe 2.02: Domain d3hd1a_: 3hd1 A:

Lineage for d3hd1a_ (3hd1 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Escherichia coli K-12 [TaxId:83333] [189336] (3 PDB entries)

8. Domain d3hd1a_: 3hd1 A: [196450]
   automated match to d3hcxa_
   complexed with act, apc, cl, mg

Details for d3hd1a_

PDB Entry: 3hd1, 1.3 Å

PDB Description: crystal structure of e. coli hppk(n10a) in complex with mgampcpp

PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d3hd1a_:

Sequence; same for both SEQRES and ATOM records:

>d3hd1a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli K-12 [TaxId: 83333]}
tvayiaigsalaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d3hd1a_:

• d3hd1a_ is new in SCOPe 2.02-stable
  
• d3hd1a_ appears in SCOPe 2.03
  
• d3hd1a_ appears in the current release, SCOPe 2.08