![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) ![]() common fold is elaborated with additional secondary structures automatically mapped to Pfam PF01288 |
![]() | Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) |
![]() | Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189336] (12 PDB entries) |
![]() | Domain d3hd1a_: 3hd1 A: [196450] automated match to d3hcxa_ complexed with act, apc, cl, mg |
PDB Entry: 3hd1 (more details), 1.3 Å
SCOPe Domain Sequences for d3hd1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hd1a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli K-12 [TaxId: 83333]} tvayiaigsalaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
Timeline for d3hd1a_: