SCOPe 2.08: Domain d3ljwb_: 3ljw B:

Lineage for d3ljwb_ (3ljw B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d3ljwb_: 3ljw B: [196449]
   automated match to d3uvda_
   complexed with act, na

Details for d3ljwb_

PDB Entry: 3ljw, 1.5 Å

PDB Description: crystal structure of the second bromodomain of human polybromo

PDB Compounds: (B:) Protein polybromo-1

SCOPe Domain Sequences for d3ljwb_:

Sequence; same for both SEQRES and ATOM records:

>d3ljwb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tegsspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlkti
aqriqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhema

Timeline for d3ljwb_:

• d3ljwb_ first appeared in SCOPe 2.02
  
• d3ljwb_ appears in SCOPe 2.07