SCOPe 2.03: Domain d3kypf_: 3kyp F:

Lineage for d3kypf_ (3kyp F:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.305: NAP-like [143112] (1 superfamily)
   core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix

4. Superfamily d.305.1: NAP-like [143113] (2 families)

5. Family d.305.1.0: automated matches [196445] (1 protein)
   not a true family

6. Protein automated matches [196446] (1 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (1 PDB entry)

8. Domain d3kypf_: 3kyp F: [196448]
   automated match to d2e50b_

Details for d3kypf_

PDB Entry: 3kyp, 2.8 Å

PDB Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum

PDB Compounds: (F:) Nucleosome assembly protein

SCOPe Domain Sequences for d3kypf_:

Sequence, based on SEQRES records:

>d3kypf_ d.305.1.0 (F:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhpa
lsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnqe
kvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirreiw
hnplsyyl

Sequence, based on observed residues (ATOM records):

>d3kypf_ d.305.1.0 (F:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhpa
lsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvkvvectr
ikwkegknpiakwsifewfttdelqdkpdvgelirreiwhnplsyyl

Timeline for d3kypf_:

• d3kypf_ first appeared in SCOPe 2.02
  
• d3kypf_ appears in SCOPe 2.04
  
• d3kypf_ last appears in SCOPe 2.06