Lineage for d3ipza_ (3ipz A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2135064Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (16 PDB entries)
  8. 2135093Domain d3ipza_: 3ipz A: [196442]
    automated match to d2yana_

Details for d3ipza_

PDB Entry: 3ipz (more details), 2.4 Å

PDB Description: Crystal structure of Arabidopsis monothiol glutaredoxin AtGRXcp
PDB Compounds: (A:) Monothiol glutaredoxin-S14, chloroplastic

SCOPe Domain Sequences for d3ipza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ipza_ c.47.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
saltpqlkdtleklvnsekvvlfmkgtrdfpmcgfsntvvqilknlnvpfedvnilenem
lrqglkeysnwptfpqlyiggeffggcditleafktgelqeevekamcs

SCOPe Domain Coordinates for d3ipza_:

Click to download the PDB-style file with coordinates for d3ipza_.
(The format of our PDB-style files is described here.)

Timeline for d3ipza_: