Lineage for d3mr7c1 (3mr7 C:1-171)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954934Species Ruegeria pomeroyi [TaxId:246200] [196436] (1 PDB entry)
  8. 2954937Domain d3mr7c1: 3mr7 C:1-171 [196437]
    Other proteins in same PDB: d3mr7a2, d3mr7b2, d3mr7c2
    automated match to d3r5ga_

Details for d3mr7c1

PDB Entry: 3mr7 (more details), 2.6 Å

PDB Description: Crystal Structure of Adenylate/Guanylate Cyclase/Hydrolase from Silicibacter pomeroyi
PDB Compounds: (C:) Adenylate/guanylate cyclase/hydrolase, alpha/beta fold family

SCOPe Domain Sequences for d3mr7c1:

Sequence, based on SEQRES records: (download)

>d3mr7c1 d.58.29.0 (C:1-171) automated matches {Ruegeria pomeroyi [TaxId: 246200]}
errlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgmlar
fdtaqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnvaarl
eaisepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpda

Sequence, based on observed residues (ATOM records): (download)

>d3mr7c1 d.58.29.0 (C:1-171) automated matches {Ruegeria pomeroyi [TaxId: 246200]}
errlcailaadmagysrlmetdvlnrqklyrrelidpaiaqaggqivkttgdgmlarfdt
aqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnvaarleai
sepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpda

SCOPe Domain Coordinates for d3mr7c1:

Click to download the PDB-style file with coordinates for d3mr7c1.
(The format of our PDB-style files is described here.)

Timeline for d3mr7c1: