![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.5: Moesin tail domain [48678] (1 family) ![]() |
![]() | Family a.137.5.1: Moesin tail domain [48679] (1 protein) |
![]() | Protein Moesin tail domain [48680] (1 species) string of short helices masking the FERM domain surface |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48681] (1 PDB entry) |
![]() | Domain d1ef1d_: 1ef1 D: [19643] Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1a3, d1ef1b1, d1ef1b2, d1ef1b3 complexed with so4 |
PDB Entry: 1ef1 (more details), 1.9 Å
SCOPe Domain Sequences for d1ef1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef1d_ a.137.5.1 (D:) Moesin tail domain {Human (Homo sapiens) [TaxId: 9606]} aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae nmrlgrdkyktlrqirqgntkqridefesm
Timeline for d1ef1d_: