| Class a: All alpha proteins [46456] (151 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies) |
Superfamily a.137.5: Moesin tail domain [48678] (1 family) ![]() |
| Family a.137.5.1: Moesin tail domain [48679] (1 protein) |
| Protein Moesin tail domain [48680] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48681] (1 PDB entry) |
| Domain d1ef1d_: 1ef1 D: [19643] Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1a3, d1ef1b1, d1ef1b2, d1ef1b3 |
PDB Entry: 1ef1 (more details), 1.9 Å
SCOP Domain Sequences for d1ef1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef1d_ a.137.5.1 (D:) Moesin tail domain {Human (Homo sapiens)}
aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
nmrlgrdkyktlrqirqgntkqridefesm
Timeline for d1ef1d_: