Lineage for d3ag7a1 (3ag7 A:551-650)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689904Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2689905Protein automated matches [190750] (8 species)
    not a true protein
  7. 2689934Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196421] (1 PDB entry)
  8. 2689935Domain d3ag7a1: 3ag7 A:551-650 [196422]
    Other proteins in same PDB: d3ag7a2
    automated match to d1nz6a_

Details for d3ag7a1

PDB Entry: 3ag7 (more details), 1.8 Å

PDB Description: An auxilin-like J-domain containing protein, JAC1 J-domain
PDB Compounds: (A:) Putative uncharacterized protein F9E10.5

SCOPe Domain Sequences for d3ag7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag7a1 a.2.3.0 (A:551-650) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeiknidakirkwssgksgnirsllstlqyilwsgsgwkpvplmdmiegnavrksyqral
lilhpdklqqkgasanqkymaekvfellqeawdhfntlgp

SCOPe Domain Coordinates for d3ag7a1:

Click to download the PDB-style file with coordinates for d3ag7a1.
(The format of our PDB-style files is described here.)

Timeline for d3ag7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ag7a2