![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.3: Chaperone J-domain [46565] (2 families) ![]() |
![]() | Family a.2.3.0: automated matches [191473] (1 protein) not a true family |
![]() | Protein automated matches [190750] (8 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196421] (1 PDB entry) |
![]() | Domain d3ag7a1: 3ag7 A:551-650 [196422] Other proteins in same PDB: d3ag7a2 automated match to d1nz6a_ |
PDB Entry: 3ag7 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag7a1 a.2.3.0 (A:551-650) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eeiknidakirkwssgksgnirsllstlqyilwsgsgwkpvplmdmiegnavrksyqral lilhpdklqqkgasanqkymaekvfellqeawdhfntlgp
Timeline for d3ag7a1: