Lineage for d1ef1c_ (1ef1 C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449350Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 449413Superfamily a.137.5: Moesin tail domain [48678] (1 family) (S)
  5. 449414Family a.137.5.1: Moesin tail domain [48679] (1 protein)
  6. 449415Protein Moesin tail domain [48680] (1 species)
    string of short helices masking the FERM domain surface
  7. 449416Species Human (Homo sapiens) [TaxId:9606] [48681] (1 PDB entry)
  8. 449417Domain d1ef1c_: 1ef1 C: [19642]
    Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1a3, d1ef1b1, d1ef1b2, d1ef1b3

Details for d1ef1c_

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1c_ a.137.5.1 (C:) Moesin tail domain {Human (Homo sapiens)}
aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
nmrlgrdkyktlrqirqgntkqridefesm

SCOP Domain Coordinates for d1ef1c_:

Click to download the PDB-style file with coordinates for d1ef1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ef1c_: