SCOP 1.67: Domain d1ef1c_: 1ef1 C:

Lineage for d1ef1c_ (1ef1 C:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
   not a true fold

4. Superfamily a.137.5: Moesin tail domain [48678] (1 family)

5. Family a.137.5.1: Moesin tail domain [48679] (1 protein)

6. Protein Moesin tail domain [48680] (1 species)
   string of short helices masking the FERM domain surface

7. Species Human (Homo sapiens) [TaxId:9606] [48681] (1 PDB entry)

8. Domain d1ef1c_: 1ef1 C: [19642]
   Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1a3, d1ef1b1, d1ef1b2, d1ef1b3

Details for d1ef1c_

PDB Entry: 1ef1, 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1c_:

Sequence; same for both SEQRES and ATOM records:

>d1ef1c_ a.137.5.1 (C:) Moesin tail domain {Human (Homo sapiens)}
aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
nmrlgrdkyktlrqirqgntkqridefesm

Timeline for d1ef1c_:

• d1ef1c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ef1c_ appears in SCOP 1.65
  
• d1ef1c_ appears in SCOP 1.69
  
• d1ef1c_ appears in the current release, SCOPe 2.08