Lineage for d3ncca_ (3ncc A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1085916Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1085917Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1085918Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1085989Protein automated matches [190263] (1 species)
    not a true protein
  7. 1085990Species Human (Homo sapiens) [TaxId:9606] [187052] (6 PDB entries)
  8. 1085994Domain d3ncca_: 3ncc A: [196419]
    automated match to d2q98a_
    complexed with cl, co3, na; mutant

Details for d3ncca_

PDB Entry: 3ncc (more details), 2.5 Å

PDB Description: a human prolactin receptor antagonist in complex with the mutant extracellular domain h188a of the human prolactin receptor
PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d3ncca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncca_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
ihnnnc

SCOPe Domain Coordinates for d3ncca_:

Click to download the PDB-style file with coordinates for d3ncca_.
(The format of our PDB-style files is described here.)

Timeline for d3ncca_: