SCOPe 2.06: Domain d3ncea_: 3nce A:

Lineage for d3ncea_ (3nce A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein automated matches [190263] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187052] (12 PDB entries)

8. Domain d3ncea_: 3nce A: [196418]
   Other proteins in same PDB: d3nceb1, d3nceb2
   automated match to d2q98a_
   complexed with cl, co3, na; mutant

Details for d3ncea_

PDB Entry: 3nce, 2 Å

PDB Description: a mutant human prolactin receptor antagonist h27a in complex with the mutant extracellular domain h188a of the human prolactin receptor

PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d3ncea_:

Sequence; same for both SEQRES and ATOM records:

>d3ncea_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrdlfdravvlsayihnlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
ihnnnc

Timeline for d3ncea_:

• d3ncea_ first appeared in SCOPe 2.02
  
• d3ncea_ appears in SCOPe 2.05
  
• d3ncea_ appears in SCOPe 2.07
  
• d3ncea_ appears in the current release, SCOPe 2.08