| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
| Protein automated matches [190263] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187052] (14 PDB entries) |
| Domain d3ncfa_: 3ncf A: [196417] Other proteins in same PDB: d3ncfb1, d3ncfb2 automated match to d2q98a_ complexed with cl, na; mutant |
PDB Entry: 3ncf (more details), 2.8 Å
SCOPe Domain Sequences for d3ncfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncfa_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrdlfdravvlshyianlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
ihnnnc
Timeline for d3ncfa_: