Lineage for d3ncfa_ (3ncf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705528Protein automated matches [190263] (1 species)
    not a true protein
  7. 2705529Species Human (Homo sapiens) [TaxId:9606] [187052] (14 PDB entries)
  8. 2705547Domain d3ncfa_: 3ncf A: [196417]
    Other proteins in same PDB: d3ncfb1, d3ncfb2
    automated match to d2q98a_
    complexed with cl, na; mutant

Details for d3ncfa_

PDB Entry: 3ncf (more details), 2.8 Å

PDB Description: a mutant human prolactin receptor antagonist h30a in complex with the mutant extracellular domain h188a of the human prolactin receptor
PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d3ncfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncfa_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrdlfdravvlshyianlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
ihnnnc

SCOPe Domain Coordinates for d3ncfa_:

Click to download the PDB-style file with coordinates for d3ncfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ncfa_: