Lineage for d3oacd_ (3oac D:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.128: Terpenoid synthases [48575] (1 superfamily)
multihelical; core: 8 helices (C-J) are arranged in 2 parallel layersSuperfamily a.128.1: Terpenoid synthases [48576] (6 families) 
duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-JFamily a.128.1.0: automated matches [196408] (1 protein)
not a true familyProtein automated matches [196409] (30 species)
not a true protein
Species Mentha x [TaxId:34256] [196410] (7 PDB entries) 
Domain d3oacd_: 3oac D: [196411]
automated match to d3p8ra_
complexed with dst, ipe, mg; mutant
Details for d3oacd_
PDB Entry: 3oac (more details), 2.6 Å
PDB Description: mint deletion mutant of heterotetrameric geranyl pyrophosphate synthase in complex with ligands
PDB Compounds: (D:) Geranyl diphosphate synthase large subunitSCOPe Domain Sequences for d3oacd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oacd_ a.128.1.0 (D:) automated matches {Mentha x [TaxId: 34256]}
mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn
SCOPe Domain Coordinates for d3oacd_:
Click to download the PDB-style file with coordinates for d3oacd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3oacd_:
- d3oacd_ first appeared in SCOPe 2.02
- d3oacd_ appears in SCOPe 2.04
- d3oacd_ is called d3oacd1 in SCOPe 2.06
- d3oacd_ appears in the current release, SCOPe 2.08, called d3oacd1
View in 3D
