Lineage for d3oacd_ (3oac D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749121Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1749122Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1749472Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1749473Protein automated matches [196409] (30 species)
    not a true protein
  7. 1749527Species Mentha x [TaxId:34256] [196410] (7 PDB entries)
  8. 1749541Domain d3oacd_: 3oac D: [196411]
    automated match to d3p8ra_
    complexed with dst, ipe, mg; mutant

Details for d3oacd_

PDB Entry: 3oac (more details), 2.6 Å

PDB Description: mint deletion mutant of heterotetrameric geranyl pyrophosphate synthase in complex with ligands
PDB Compounds: (D:) Geranyl diphosphate synthase large subunit

SCOPe Domain Sequences for d3oacd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oacd_ a.128.1.0 (D:) automated matches {Mentha x [TaxId: 34256]}
mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn

SCOPe Domain Coordinates for d3oacd_:

Click to download the PDB-style file with coordinates for d3oacd_.
(The format of our PDB-style files is described here.)

Timeline for d3oacd_: