SCOPe 2.02: Domain d3oacd_: 3oac D:

Lineage for d3oacd_ (3oac D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (3 species)
   not a true protein

7. Species Mentha x [TaxId:34256] [196410] (1 PDB entry)

8. Domain d3oacd_: 3oac D: [196411]
   automated match to d3p8ra_
   complexed with dst, ipe, mg; mutant

Details for d3oacd_

PDB Entry: 3oac, 2.6 Å

PDB Description: mint deletion mutant of heterotetrameric geranyl pyrophosphate synthase in complex with ligands

PDB Compounds: (D:) Geranyl diphosphate synthase large subunit

SCOPe Domain Sequences for d3oacd_:

Sequence; same for both SEQRES and ATOM records:

>d3oacd_ a.128.1.0 (D:) automated matches {Mentha x [TaxId: 34256]}
mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn

Timeline for d3oacd_:

• d3oacd_ is new in SCOPe 2.02-stable
  
• d3oacd_ appears in SCOPe 2.03
  
• d3oacd_ appears in the current release, SCOPe 2.08, called d3oacd1