Lineage for d3p5mf1 (3p5m F:1-251)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (52 species)
    not a true protein
  7. 2100325Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries)
  8. 2100332Domain d3p5mf1: 3p5m F:1-251 [196406]
    Other proteins in same PDB: d3p5ma2, d3p5mb2, d3p5mc2, d3p5md2, d3p5mf2
    automated match to d2ej5a_
    complexed with edo

Details for d3p5mf1

PDB Entry: 3p5m (more details), 2.05 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium
PDB Compounds: (F:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3p5mf1:

Sequence, based on SEQRES records: (download)

>d3p5mf1 c.14.1.0 (F:1-251) automated matches {Mycobacterium avium [TaxId: 243243]}
mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc
sggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasy
fqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeye
svltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregaraf
rerrtpnfrgh

Sequence, based on observed residues (ATOM records): (download)

>d3p5mf1 c.14.1.0 (F:1-251) automated matches {Mycobacterium avium [TaxId: 243243]}
mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc
sggdldtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyfql
aftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyesvl
tdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafrer
rtpnfrgh

SCOPe Domain Coordinates for d3p5mf1:

Click to download the PDB-style file with coordinates for d3p5mf1.
(The format of our PDB-style files is described here.)

Timeline for d3p5mf1: