SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3p5mf1 (3p5m F:1-251)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (53 species)
    not a true protein
  7. 2100325Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries)
  8. 2100332Domain d3p5mf1: 3p5m F:1-251 [196406]
    Other proteins in same PDB: d3p5ma2, d3p5mb2, d3p5mc2, d3p5md2, d3p5mf2
    automated match to d2ej5a_
    complexed with edo

Details for d3p5mf1

PDB Entry: 3p5m (more details), 2.05 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium
PDB Compounds: (F:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3p5mf1:

Sequence, based on SEQRES records: (download)

>d3p5mf1 c.14.1.0 (F:1-251) automated matches {Mycobacterium avium [TaxId: 243243]}
mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc
sggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasy
fqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeye
svltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregaraf
rerrtpnfrgh

Sequence, based on observed residues (ATOM records): (download)

>d3p5mf1 c.14.1.0 (F:1-251) automated matches {Mycobacterium avium [TaxId: 243243]}
mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc
sggdldtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyfql
aftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyesvl
tdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafrer
rtpnfrgh

SCOPe Domain Coordinates for d3p5mf1:

Click to download the PDB-style file with coordinates for d3p5mf1.
(The format of our PDB-style files is described here.)

Timeline for d3p5mf1: