Lineage for d3peaf_ (3pea F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100058Species Bacillus anthracis [TaxId:261594] [196404] (1 PDB entry)
  8. 2100064Domain d3peaf_: 3pea F: [196405]
    Other proteins in same PDB: d3peac2
    automated match to d3q0ja_
    complexed with act, flc, pg4

Details for d3peaf_

PDB Entry: 3pea (more details), 1.82 Å

PDB Description: crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor'
PDB Compounds: (F:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d3peaf_:

Sequence, based on SEQRES records: (download)

>d3peaf_ c.14.1.0 (F:) automated matches {Bacillus anthracis [TaxId: 261594]}
mlkflsvrvedhiavatlnhapanamssqvmhdvtelidqvekddnirvvvihgegrffs
agadikeftsvteakqatelaqlgqvtfervekcskpviaaihgaalggglefamschmr
fatesaklglpeltlglipgfagtqrlpryvgkakacemmltstpitgaealkwglvngv
faeetflddtlkvakqiagkspataravlellqttksshyyegvqreaqifgevftsedg
regvaaflekrkpsfsg

Sequence, based on observed residues (ATOM records): (download)

>d3peaf_ c.14.1.0 (F:) automated matches {Bacillus anthracis [TaxId: 261594]}
mlkflsvrvedhiavatlnhapanamssqvmhdvtelidqvekddnirvvvihgegrffs
agadikeftsteakqatelaqlgqvtfervekcskpviaaihgaalggglefamschmrf
atesaklglpeltlglipgfagtqrlpryvgkakacemmltstpitgaealkwglvngvf
aeetflddtlkvakqiagkspataravlellqttksshyyegvqreaqifgevftsedgr
egvaaflekrkpsfsg

SCOPe Domain Coordinates for d3peaf_:

Click to download the PDB-style file with coordinates for d3peaf_.
(The format of our PDB-style files is described here.)

Timeline for d3peaf_: