Lineage for d2x1ka_ (2x1k A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127290Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1127291Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1127292Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 1127398Protein automated matches [190383] (4 species)
    not a true protein
  7. 1127401Species Deinococcus radiodurans [TaxId:1299] [187232] (3 PDB entries)
  8. 1127403Domain d2x1ka_: 2x1k A: [196402]
    automated match to d2vpaa_
    complexed with act; mutant

Details for d2x1ka_

PDB Entry: 2x1k (more details), 1.55 Å

PDB Description: h71s mutant of the antibiotic resistance protein nima from deinococcus radiodurans
PDB Compounds: (A:) nima-related protein

SCOPe Domain Sequences for d2x1ka_:

Sequence, based on SEQRES records: (download)

>d2x1ka_ b.45.1.1 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
syyhhhhhhlestslykkaglsdfydprerdpsvsrrpqnrqsdewirelllrgtiarva
tlwqgedgaafpfitplayayrpeqgdlvystnvvgrlranagqghpatlevseigqflp
snsplelsvqyrsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkrt
svyslsidrwsgkenwaeqaiqeedwpalgpewlg

Sequence, based on observed residues (ATOM records): (download)

>d2x1ka_ b.45.1.1 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
syyhhhhhhlelsdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedga
afpfitplayayrpeqgdlvystnvvgrlranagqghpatlevseigqflpsnsplelsv
qyrsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidr
wsgkenwaeqaiqeedwpalgpewlg

SCOPe Domain Coordinates for d2x1ka_:

Click to download the PDB-style file with coordinates for d2x1ka_.
(The format of our PDB-style files is described here.)

Timeline for d2x1ka_: