Lineage for d3mywi_ (3myw I:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2636664Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2636665Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2636691Protein automated matches [192457] (4 species)
    not a true protein
  7. 2636702Species Vigna radiata [TaxId:3916] [196395] (3 PDB entries)
  8. 2636705Domain d3mywi_: 3myw I: [196396]
    Other proteins in same PDB: d3mywa_, d3mywb_
    automated match to d2r33a1
    complexed with ca

Details for d3mywi_

PDB Entry: 3myw (more details), 2.5 Å

PDB Description: the bowman-birk type inhibitor from mung bean in ternary complex with porcine trypsin
PDB Compounds: (I:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d3mywi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mywi_ g.3.13.1 (I:) automated matches {Vigna radiata [TaxId: 3916]}
ccdscdctkskppqchcanirlnschsackscictrsmpgkcrcldtddfcykpc

SCOPe Domain Coordinates for d3mywi_:

Click to download the PDB-style file with coordinates for d3mywi_.
(The format of our PDB-style files is described here.)

Timeline for d3mywi_: