Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) |
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
Protein automated matches [192457] (4 species) not a true protein |
Species Vigna radiata [TaxId:3916] [196395] (3 PDB entries) |
Domain d3mywi_: 3myw I: [196396] Other proteins in same PDB: d3mywa_, d3mywb_ automated match to d2r33a1 complexed with ca |
PDB Entry: 3myw (more details), 2.5 Å
SCOPe Domain Sequences for d3mywi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mywi_ g.3.13.1 (I:) automated matches {Vigna radiata [TaxId: 3916]} ccdscdctkskppqchcanirlnschsackscictrsmpgkcrcldtddfcykpc
Timeline for d3mywi_: